Protein Info for GFF6381 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 643 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 378 to 395 (18 residues), see Phobius details amino acids 401 to 420 (20 residues), see Phobius details amino acids 427 to 447 (21 residues), see Phobius details amino acids 471 to 490 (20 residues), see Phobius details amino acids 521 to 540 (20 residues), see Phobius details amino acids 560 to 583 (24 residues), see Phobius details amino acids 594 to 614 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 10 to 290 (281 residues), 117.9 bits, see alignment E=2.4e-38 amino acids 350 to 605 (256 residues), 138.1 bits, see alignment E=1.6e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein K01998, branched-chain amino acid transport system permease protein (inferred from 97% identity to vpe:Varpa_0212)

Predicted SEED Role

"putative permease component of branched-chain amino acid transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (643 amino acids)

>GFF6381 ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MSFSGFVVQLLNGLAGASSLFFVAAGLSLIFGVTRIVNFAHGSFFMVGIYVAYTLVDKLG
SSLGFWPALLIAAVAVGVLGALIEVVLLRRIYKAPELFQLLATFALVLVIKDAVLWLWGP
DELLGPRAPGLKGSVEILGRQFPSYDLFLIVVGPLVLGLVWLLLTRTRFGTLVRAATQDR
EMVSALGVNQAWLFTAVFALGALLAGLGGALQLPREPATLEMDLNTIGAAFVVVVVGGMG
SLPGAYVAALLIAEIKAVCIWLGVVQIFGIDVSFSKLTLMVDFLVMAIVLVWRPWGLFGR
PQAPSRYVGMQEEPLRRPSNAYLIAAAVLALMLAALPLLTVNSPYTMVLMIDLLIAALFA
TSLHFIMGPAGMHSFGHAAYFGLGAYGAALLVRSLHLPMEVALLVAPVVAALGALVYGWF
AVRLSGVYLAMLTLAFAQITWAITYQWDSFTGGSNGLTGVWPSEWLSNKQAYYWLTLVLV
GAGVWWLRRVLFSPFGYALRAGRDSVLRADAIGIDVKRMQWAAFVIAGTVAGLAGALYAF
SKGSISPESLSVGKSVDGLVMVLLGGIQTLAGPVVGAVTFTWLHDTVARNTDYWRAMLGA
IILILVLLFPQGIAGSIKQLAERWRAPRHDADAEKAKLEEVKA