Protein Info for GFF6376 in Variovorax sp. SCN45

Annotation: Uncharacterized aldehyde oxidase, 2Fe-2S subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 14 to 61 (48 residues), 33.1 bits, E=4.2e-12
• PF01799: Fer2_2
  • amino acids 81 to 154 (74 residues), 95.2 bits, E=2e-31

Best Hits

Swiss-Prot: 68% identical to NICA_PSEPK: Nicotinate dehydrogenase subunit A (nicA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_0217)

MetaCyc: 68% identical to nicotinate hydroxylase small subunit (Pseudomonas putida KT2440)
NICOTINATE-DEHYDROGENASE-RXN [EC: 1.17.2.1]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

• nicotinate degradation I (1/6 steps found)
• superpathway of nicotinate degradation (5/18 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.17.2.1 or 1.3.99.16

Protein Sequence (166 amino acids)

>GFF6376 Uncharacterized aldehyde oxidase, 2Fe-2S subunit (Variovorax sp. SCN45)
VTASCGAEPLHLLVNGQARSIEGVPRAATLLHMLRNDLGLNGPKYGCGLGQCGACTVHVD
GVAARSCVIPAHGVAGRAITTLEGLGSRGDWHPVQAAFEEAQAAQCGYCLNGMVMQAAAL
LARDPHASEARIRSELSGNLCRCGTHIEILDAVQRAAARMCARQEP