Protein Info for GFF6365 in Variovorax sp. SCN45

Annotation: T6SS AAA+ chaperone ClpV (TssH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 906 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 891 (879 residues), 1229.9 bits, see alignment E=0 PF02861: Clp_N" amino acids 26 to 75 (50 residues), 20.7 bits, see alignment 2.1e-07 PF00004: AAA" amino acids 233 to 365 (133 residues), 38.4 bits, see alignment E=9.1e-13 amino acids 640 to 724 (85 residues), 29.9 bits, see alignment E=3.7e-10 PF17871: AAA_lid_9" amino acids 373 to 462 (90 residues), 100.4 bits, see alignment E=2.7e-32 PF07724: AAA_2" amino acids 634 to 800 (167 residues), 184.7 bits, see alignment E=8.1e-58 PF00158: Sigma54_activat" amino acids 638 to 756 (119 residues), 21.3 bits, see alignment E=1e-07 PF07728: AAA_5" amino acids 639 to 759 (121 residues), 38.3 bits, see alignment E=7.3e-13 PF10431: ClpB_D2-small" amino acids 807 to 881 (75 residues), 51.3 bits, see alignment E=5.3e-17

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 67% identity to bpt:Bpet4107)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (906 amino acids)

>GFF6365 T6SS AAA+ chaperone ClpV (TssH) (Variovorax sp. SCN45)
MTDIRRVSLFSKLNPMLYKALETATAFAKLRGNAYVELVHWLHQILQLQDSDMLRIIKRA
GLNLDAVENDLVRALDRLPHGATSISDISEHVDNAVERAWVYASLRFEATSIRGAYLLAG
IIKTPGLRQVLSGISREFDKIVPDVLVAQLAAWTEGSPEDDHDVAAAPGVPAVASANAHQ
GDGAPAGGSALAKYASDLTAKARAGELDPVYGRDDEIRQIIDILMRRRQNNPLLTGEAGV
GKTAVVEGLASRLAAGDVPPSLKDVSLWVLDPTLLQAGAGVKGEFEQRLRQVIDEVEKSP
KPIVLFVDEVHTLVGAGGTAGTGDAANLLKPALARGRLRTIGATTWSEYKKYIEKDPALT
RRFQTIQVHEPTEPKAVVMLRGISAELEKHHGVLILDAALEAAVSLSHRYIPARQLPDKA
VSLLDTACARVALSQHALPAAIEDLQRRIEVLGIESGIAGREAAIGVGEHQRVEDIAAQV
AEAQAELELLETRRVEESALVERIVALRKQLSPAAVPQAGADDDAKSQDAQASDTDPAKT
AEEIRAELAQAQDRLVQLQGESPLILAAVDAQAIATVVADWTGIPIGRMVRDDAQSVLKL
GEILSARVVAQPDALETISRRIRTARARLDNPNKPVGVFLLCGPSGVGKTETALALSEAL
YGGEQNLVTINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKA
HTDVHEIFFQVFDKGWMEDGEGRHIDFRNTVIIMTSNVGTDLVMQLCEDPDLRPDPEPLA
NALREPLLKVFAPALLGRLVVVPYYPLHAQALHRIIRLQLDRIAARLAANHGITLVYDDS
AVELVARRCTAIESGGRMIDAILTHTILPRLSEEVIGATVSARKLAGVRLSAEGDDFHYE
FSEAER