Protein Info for GFF6362 in Variovorax sp. SCN45

Annotation: Pentapeptide repeat family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 867 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF09937: DUF2169" amino acids 20 to 298 (279 residues), 249.5 bits, see alignment E=9.6e-78 PF13599: Pentapeptide_4" amino acids 547 to 608 (62 residues), 29.1 bits, see alignment 2.1e-10 amino acids 621 to 690 (70 residues), 41.9 bits, see alignment E=2e-14 amino acids 686 to 781 (96 residues), 28.4 bits, see alignment E=3.4e-10 amino acids 751 to 829 (79 residues), 28 bits, see alignment E=4.5e-10 PF00805: Pentapeptide" amino acids 547 to 570 (24 residues), 21.4 bits, see alignment (E = 3.1e-08) amino acids 571 to 608 (38 residues), 33.8 bits, see alignment (E = 3.9e-12) amino acids 606 to 641 (36 residues), 24.6 bits, see alignment (E = 2.9e-09) amino acids 737 to 767 (31 residues), 20.2 bits, see alignment (E = 7.3e-08) amino acids 755 to 786 (32 residues), 33.3 bits, see alignment (E = 5.5e-12) amino acids 799 to 837 (39 residues), 30.3 bits, see alignment (E = 4.9e-11)

Best Hits

Predicted SEED Role

"FIG00431837: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (867 amino acids)

>GFF6362 Pentapeptide repeat family protein (Variovorax sp. SCN45)
MKIVKPFRLSVLTRPQRWRGNDMLGVAVLALASLEDEPRLMPEQELWQAAAEDIGPGNIL
DLGMPKHEPEWLASGHAYTAHQADKTMCAVKMAVAGSEKRLHVSGDRYWLDGRITPPQPF
DSMPLDWAHAYGGASVPQNPQGIGSVDELVNGVRTRRLPNVESPDARMSAPGRAVRPASL
GAIPPDWPQRAQLLGSSYGQQWLQTQYPGPADDMDWRYFNAAPPEQRWPGMQELPAGAPY
EIWNMHPDEPVLQGALPRWRTRCFASWQADGSELRETPLRLSTAWFFPHRRRVILIWHGS
FAIAEDDAADMKHIMPALELENEPRPHAHYQSVLRLRLDPKSAVHAVRDSDLVPKAVMGA
WAGDRLPDASTKPSVRNQRAGQLRAHEHERARLLGEGLDPDKLLPQPVKIEGSFTLDDLP
EYSERMEAEIARTREDLKTRTEQAVAASRHDGSSPPGAPQRNRFDPDKVIAELAQLEAFG
EQARLLPPEAQAGARAEAAQARERMAAQIRQGHLYTAHLLDAAPPASSFRTAKLRRRLGR
AEAGQRNFARMNLIGADLSDMDLSGADFTGANLEDANLQGARLAGCNFTQAVLARARLER
AVLADCRFDHANLGAALCDGADFSRASLRHANCSKTVFRACAMGSAVFEATHVHESVWQR
CDLRQSRWLQVAMIKMRFEDVSFEEASFRQMGWIECALVGVSFARATLEGCGFTRLAGNE
GLDFTGATLVSSSFGYHSSLAGAVLRDAVLRHCGLRGVTLAGADLRGVRLEGCDFSGCDL
RGAKLDRLVGGESLFIRTDFTGASLAGADFIDSNLSKSDLRLADLHDANLFRADVSQAFI
DGTTRLDGAYTHHAKVLPARRAGPDDR