Protein Info for GFF636 in Xanthobacter sp. DMC5

Annotation: Heme/hemopexin utilization protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 735 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 57 to 718 (662 residues), 529.1 bits, see alignment E=1.9e-162 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 58 to 706 (649 residues), 376.7 bits, see alignment E=2.3e-116 PF07715: Plug" amino acids 72 to 180 (109 residues), 72.6 bits, see alignment E=3.6e-24 PF00593: TonB_dep_Rec_b-barrel" amino acids 271 to 694 (424 residues), 157.7 bits, see alignment E=9.5e-50

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 79% identity to xau:Xaut_4191)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (735 amino acids)

>GFF636 Heme/hemopexin utilization protein C (Xanthobacter sp. DMC5)
MAGEPQRMAVFKGEGHRRGKEALLAGVALCAVLMATPVRAQSAPDAGPTDDTTAISLDTI
TVAASLTEERAIDALAAISVVRPDDLEQLMPSRTQDVFFGMPGTTVIQNGNSTQASINIR
GMEDYGRVAVFIDGARQNFTQLGHGTGAGSFFLEPGLLADVDVVRGPVANIYGSGAIGGV
VTFRTKDANDIIKPGQTWGVESAGEFGSNGPMGYGALFAAAKVNPNIDLFFGGTYRSQGD
YTDGDGNVVPGTGSDIWTGVAKLTFRPADHHEVKITGINYSADYTTYNAALVNNKIPSGS
TQYGTTVLNQTLTASWNYSNPDDNIFDWRSQIYWNRVKQDQLKVAGTPSSITGSVGDPRY
FTIDTLGFDLNNTSRFTFADIRNAITIGGDYFHDDVDNVDNYGFGDGYNPSGERGVGGAF
IQWKANYSTWFEAIGALRYDTYNLSGDGVSTSGDHLSPKITLGLTPWQWVTLYGTFAEGY
RAPAVTETLVNGAHPPNIPLVFCPDGSYGVFCFVPNPYLKPEIGKNKEIGLNLRFDDIFT
KGDKFRAKANVYQNDVEDYIELIGYDKTPFGTYANYQYQNIANARLRGFEFESNYDAGVW
FAGFNATVSEGENTNNGQPLANVMPNTIATTLGARFFENKLTVSVRWQWVAAKTAADLPA
DSPYEPTPSFNLVNVYLGYQPDPNVLAQLSVENLFNEQYVQYQQFLPSAGITAKAGLKFK
IGADTIAAATPYPVK