Protein Info for GFF6353 in Variovorax sp. SCN45

Annotation: T6SS outer membrane component TssL (ImpK/VasF) / OmpA/MotB domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 177 to 193 (17 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 65 to 272 (208 residues), 247 bits, see alignment E=1.7e-77 PF09850: DotU" amino acids 66 to 267 (202 residues), 253.7 bits, see alignment E=1.3e-79 TIGR03350: type VI secretion system peptidoglycan-associated domain" amino acids 300 to 435 (136 residues), 167.5 bits, see alignment E=1.6e-53 PF00691: OmpA" amino acids 332 to 430 (99 residues), 53.6 bits, see alignment E=2.4e-18

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 90% identity to vap:Vapar_0212)

Predicted SEED Role

"Outer membrane protein ImpK/VasF, OmpA/MotB domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>GFF6353 T6SS outer membrane component TssL (ImpK/VasF) / OmpA/MotB domain (Variovorax sp. SCN45)
MNGVNDMAVGAGGFVPPNPGGGAAAADMGGMPAAQRGMGAQPESFTAWHDARRPHAGDTA
LAGNNPLVAAANPLLDLIPQIRATGHHPAPAQLREHLVDEVRRFETRAQQAGIAPEVIIG
ARYCLCTAVDEAAALTPWGGSIWSSQSLLVMFHNETWGGEKFFQLLSRLVQNPQQHLHLI
ELIYFCLALGFEGRFRVIDNGRSQLETLKQRLLQIIRQTRGEIAVPLSPHWQDASAPVRR
TRNWLPVWAVGAVAAVLLLVAFALLTFNLAGTSDGAFAAVNAVRLPQTARAVVMPAPTPR
LQRFLEPEIRDGLLTVRDEADRSVVVLRGDGLFASGSDRVLDRYAPVLARVADALNAVEG
NVLISGFSDDQPIRSVRFPSNWQLSQARADAVKKMIATRLARPERLRAEGRGDADPLVPN
DSPANRARNRRVEVTLLVAPVAGVPAPAPQPQGGAR