Protein Info for GFF635 in Variovorax sp. SCN45

Annotation: Urea ABC transporter, permease protein UrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 59 (12 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 12 to 303 (292 residues), 393.8 bits, see alignment E=3e-122 PF02653: BPD_transp_2" amino acids 16 to 290 (275 residues), 131.6 bits, see alignment E=1.5e-42

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 96% identity to vap:Vapar_3144)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>GFF635 Urea ABC transporter, permease protein UrtB (Variovorax sp. SCN45)
MTLSDMMNIGLMQGFAGLSLFAVLLLMGLGLAIIFGQMGVINMAHGEFMTIGAYSIYLAA
RVTESLAPEFMPYYFPIAIALAFVFAFIVGWIVEWALIRHLYKRPLDTLLATWGVSLGLQ
QIFRTFIGPKEVSPTLPEWLMGSWTPHEGLDIPINGLFVLVLTALVTGGVLVALHKSRWG
LRVRATVANRTMANATGIDTRKTDRLTFAIGCGIAGVAGAAFTTIGSTGPTSGSLYIVDA
FLVVTFGGAASLFGTVVSAFGIAQTQSVSEFFMTGSMAKVLTLSLIVFILMLRPQGLFAV
KVRR