Protein Info for GFF6347 in Variovorax sp. SCN45

Annotation: AAA+ ATPase superfamily protein YifB/ComM, associated with DNA recombination

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF13541: ChlI" amino acids 1 to 94 (94 residues), 94.2 bits, see alignment E=1.6e-30 TIGR00368: Mg chelatase-like protein" amino acids 1 to 460 (460 residues), 505.8 bits, see alignment E=6e-156 PF01078: Mg_chelatase" amino acids 156 to 361 (206 residues), 304.9 bits, see alignment E=7.2e-95 PF07728: AAA_5" amino acids 180 to 317 (138 residues), 38.4 bits, see alignment E=3.7e-13 PF00493: MCM" amino acids 254 to 320 (67 residues), 33.5 bits, see alignment E=7.3e-12 PF13335: Mg_chelatase_C" amino acids 368 to 460 (93 residues), 95.3 bits, see alignment E=8.2e-31

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 87% identity to vpe:Varpa_0220)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>GFF6347 AAA+ ATPase superfamily protein YifB/ComM, associated with DNA recombination (Variovorax sp. SCN45)
VRSAIQNAGLEYPNNKKIVVNLAPADLPKDSGRFDLPIALGILAASGQIDNARLAGHEFA
GELSLSGELRPVRGALAMALALHTRGVATRLVLPLDSAHEAALVPGSEVYGARHLLDVVR
QFVVDTEAASQWPDPPPDGWARVHAAPGASAPRYADLADVKGHAGAKRALEIAAAGGHSL
LMMGEPGSGKSMLAQRFAGLLPAMSIDEALESAAVASLGGRFATERWMLRPTSAPHHTSS
AVALVGGGSPPRPGEISRAHHGVLFLDEFPEFARSALEALREPLETGTITIARAARSAEF
PARFQLIAAMNPCPCGYLGSTKSKACRCTPDQISRYQGKLSGPLLDRIDLHIEVPAVSAQ
QLLDAPPGESTESIRSRVIVARERAMQRQGYANQSLQGSAIDKHAGLDDAARKFMFNAAA
KLGWSARSTHRALKVARTIADLGSAEAVQVEHLAEAVQYRRALRGIA