Protein Info for GFF634 in Pseudomonas sp. DMC3

Annotation: High-affinity zinc uptake system protein ZnuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01297: ZnuA" amino acids 27 to 300 (274 residues), 219.1 bits, see alignment E=3.9e-69

Best Hits

KEGG orthology group: K09815, zinc transport system substrate-binding protein (inferred from 94% identity to pfo:Pfl01_0059)

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF634 High-affinity zinc uptake system protein ZnuA (Pseudomonas sp. DMC3)
VSRLFSVFVAFVASFLLIGTAQAEVKVLTSIKPLQLIAAAVQDGVAIPEVLLPPGASPHN
YALRPSDVRKVQSVDLLYWIGPDMEGFLPRVLGGRSLPSVAVQDLPGLNLRHFGADNHSH
AEEADEHDHDHRPGSLDAHLWLSPVNARVIADKMAADLSAADPANAQRYQSNAKAFDERL
DALDQRLKKRLANVEGKPYFVFHEAFDYFEDAYGLKHAGVFAVAAEVQPGAQHVAAMRKR
LQEVGKTCVFSEPPLRPRLAETLVAGLPVKLAELDALGGYTPATAQGYEQVLEKLGNDLA
GCLESL