Protein Info for GFF633 in Variovorax sp. SCN45

Annotation: Urea ABC transporter, ATPase protein UrtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR03411: urea ABC transporter, ATP-binding protein UrtD" amino acids 7 to 247 (241 residues), 380.3 bits, see alignment E=2.1e-118 PF13476: AAA_23" amino acids 16 to 54 (39 residues), 28.6 bits, see alignment 4.2e-10 PF00005: ABC_tran" amino acids 24 to 177 (154 residues), 103.1 bits, see alignment E=4.1e-33 PF12399: BCA_ABC_TP_C" amino acids 224 to 247 (24 residues), 34.8 bits, see alignment (E = 2e-12)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 96% identity to vap:Vapar_3142)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>GFF633 Urea ABC transporter, ATPase protein UrtD (Variovorax sp. SCN45)
MSNTDFALAVEDLTVSFDGFKAIDDLTLYIDRNELRVIIGPNGAGKTTLLDLICGKTRAS
AGSIKFKNTELTKMAEHKRVRLGIGRKFQTPSIYENLSVFQNLEVSFPKGRSVFGALAFK
CDEEVKARVQAVADEIGLADKLETEAGLLSHGQKQWLEIGMLLMQEPELLMLDEPIAGMS
ARERELTADLLKRICQNRAVIVIEHDMAFVKQIAHKVTVMHQGKILAEGPMEKVQADPKV
IDVYLGH