Protein Info for GFF633 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: probable membrane protein YPO3302

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details PF09335: VTT_dom" amino acids 52 to 147 (96 residues), 45.5 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: None (inferred from 79% identity to aaa:Acav_0841)

Predicted SEED Role

"probable membrane protein YPO3302"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>GFF633 probable membrane protein YPO3302 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPDWITYLMELLALPEFGLSTVLVVSFISATLLPLGSEPAVFGLIKLNPHLFWPAILVAT
AGNTAGGAVSWLMGLGTHKVVDRARGNHVDLRALRWLERFGPKACLMSWLPVVGDPLCAV
AGWLKFPFWPCLAYMAIGKFARYLTMTAALLWFFPGTLHP