Protein Info for GFF6273 in Variovorax sp. SCN45

Annotation: Nicotinamide-nucleotide amidase (EC 3.5.1.42)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF02464: CinA" amino acids 18 to 165 (148 residues), 188.6 bits, see alignment E=2.7e-60 TIGR00199: amidohydrolase, PncC family" amino acids 21 to 163 (143 residues), 154.4 bits, see alignment E=1.2e-49

Best Hits

Swiss-Prot: 53% identical to PNCC_ENTAG: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Enterobacter agglomerans

KEGG orthology group: K03743, (no description) (inferred from 83% identity to vpe:Varpa_0516)

MetaCyc: 52% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

"C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>GFF6273 Nicotinamide-nucleotide amidase (EC 3.5.1.42) (Variovorax sp. SCN45)
MATTTLADLDTPALVVAAAGLLQKKGWMLATAESCTGGLIGAACTELAGSSAWFERGFIT
YSNEAKTEILGVDAALIAANGAVSEPVARAMAVGAIAHSAPSRVALAVTGVAGPTGGTPD
KPVGTVWFGWSVDGQVRTERRRFDGDRATVRAATVHYALQTLVELLSAP