Protein Info for GFF627 in Xanthobacter sp. DMC5

Annotation: Glutamine--fructose-6-phosphate aminotransferase [isomerizing]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 607 (606 residues), 782.9 bits, see alignment E=1.1e-239 PF13522: GATase_6" amino acids 64 to 191 (128 residues), 73.5 bits, see alignment E=2.5e-24 PF13537: GATase_7" amino acids 89 to 195 (107 residues), 55.2 bits, see alignment E=1.1e-18 PF01380: SIS" amino acids 291 to 412 (122 residues), 89 bits, see alignment E=3.5e-29 amino acids 459 to 590 (132 residues), 90.6 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 70% identical to GLMS_BRADU: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 92% identity to xau:Xaut_4418)

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (607 amino acids)

>GFF627 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (Xanthobacter sp. DMC5)
MCGIVGILGKSAVADKVVESLRRLEYRGYDSAGIATLENGHLEICRAEGKLRNLENKLDK
HPLKGHAGIGHTRWATHGKPSERNAHPHGTKRVAVVHNGIIENFRELKEDLKAAGVVFRS
DTDTEVVAQLVDRELLSGKEPVAAVAAVLPRLKGAFALAFLFDGKTDLMIAARRGSPLAI
GYGNGEMFLGSDAIALGPFTDRIAYLEEGDWAVLTREGAEIRDETGRIVERAVQKVPAGA
LLVDKGNHRHFMAKEIYEQPEVISHTFGHYLDLADETVSLPELPFDAKEVQHISITACGT
ALYAGAVAEYWLERFGRVPVSTDIASEFRYRETPLAPGGVTIVISQSGETADTLASLRYA
KECGQKVVAVVNVPTSTIAREADVVLPILAGPEIGVASTKAFTCQLATLACLSVAFGRAK
GVLSAEDEHKLVRAFMEVPRLMTEALKLSPEIEVLARTLAKARDVLYLGRGTNYPLALEG
ALKLKEISYIHAEGYAGGELKHGPIALIDEKMPVVVIAPHDRIFDKTVSNMEEVAARGGR
IILVTDPKGAEAAPVNAVQKLILPEMPATVCPMVYSIPVQLIAYHTAVIMGTDVDQPRNL
AKSVTVE