Protein Info for PS417_03185 in Pseudomonas simiae WCS417

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 2 to 337 (336 residues), 569.1 bits, E=1.9e-175
• PF08240: ADH_N
  • amino acids 31 to 89 (59 residues), 29.4 bits, E=8.9e-11
• PF00107: ADH_zinc_N
  • amino acids 161 to 277 (117 residues), 47.4 bits, E=2.7e-16
• PF13602: ADH_zinc_N_2
  • amino acids 194 to 334 (141 residues), 71 bits, E=3.1e-23

Best Hits

Swiss-Prot: 40% identical to ZDH1_STAAW: Zinc-type alcohol dehydrogenase-like protein MW2112 (MW2112) from Staphylococcus aureus (strain MW2)

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU0663)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See A0A1N7U1N8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PS417_03185 NADPH:quinone reductase (Pseudomonas simiae WCS417)
MKAIAYYASLPINDPNALQDIELPAPVAGPRDLLVEVKAISVNPVDTKVRQNVAPEKGAA
KVLGWDVAGVVKAVGSDVTLFKAGDNVFYAGSLVRPGGNSELHTVDERIVGHMPKSLGFA
EAAALPLTAITAWELLFERLQVQEGQQDNGQSLLIVGAAGGVGSILTQLASQLTGLKVIG
TASRPETQEWTKALGADLVIDHSQPLSDALKAAGHPQVTHVASLTQTDHHLDQLVEALQP
QGKLALIDDPKTLDVSKLKRKSLSLHWEFMYTRSMFETPDMIEQHNLLNRVAELIDAGTL
KTTVGEHFGAINAANLRRAHALLESGKAKGKIVLEGF