Protein Info for GFF627 in Variovorax sp. SCN45

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 87 to 376 (290 residues), 148 bits, see alignment E=1.6e-47 PF25917: BSH_RND" amino acids 89 to 231 (143 residues), 39 bits, see alignment E=1.2e-13 PF25973: BSH_CzcB" amino acids 90 to 221 (132 residues), 34.9 bits, see alignment E=2.3e-12 PF25954: Beta-barrel_RND_2" amino acids 237 to 311 (75 residues), 58.4 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: None (inferred from 62% identity to mms:mma_0287)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF627 Secretion protein HlyD (Variovorax sp. SCN45)
MNKKWTVPALSGFFIVSCAAWFLWARSPTESRAGTERPPQPATQLGAETLRYPEGAAQLT
MIQARAILPSRVPLADVLSARVTYDEDVTARIGVGVSGRIVDIKVAPGDTVKAGQVLAEI
DSPDFGTAAADLDKARADEERKRLAVERAKDLVSGDAIPVKEWESLQSDLAQARAETLRA
GQRLKNLNPRGLAISGQRVKLTSPIDGVVTDRTATPALEVSPGMAAPLFVVTDPKRLWLM
IDLPEKLLGRVRLKSDVSVESDAFPGQQFSARIVQLGQVVDVNTRRATARAVLANPRTEL
LPEMFVRASVLQAEGQGVRVPNSAIVNHGVYAYLFVQEAPGEFHRRKVALLTQGGDASYV
GEGLKGSELVVVKGALLLDAELTARAGDKS