Protein Info for GFF6262 in Variovorax sp. SCN45

Annotation: Transcriptional regulator PhnF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02325: phosphonate metabolism transcriptional regulator PhnF
  • amino acids 19 to 248 (230 residues), 189.5 bits, E=3.6e-60
• PF00392: GntR
  • amino acids 23 to 83 (61 residues), 73.3 bits, E=1e-24
• PF07702: UTRA
  • amino acids 112 to 243 (132 residues), 77.8 bits, E=7.2e-26

Best Hits

KEGG orthology group: K02043, GntR family transcriptional regulator, phosphonate transport system regulatory protein (inferred from 79% identity to vap:Vapar_6099)

Predicted SEED Role

"Transcriptional regulator PhnF" in subsystem Alkylphosphonate utilization

Protein Sequence (251 amino acids)

>GFF6262 Transcriptional regulator PhnF (Variovorax sp. SCN45)
MTSTTSSPASLPARSPRDSFWTRIAADIADAIARGVYPPGQRLPSEHALAEQFGVNRHTI
RRSLADLTSQGLLRVTQGSGTYVEEFAMDLALVKRPRHHQRMALAGLRGALHVVAASTVR
ATAAQARVLDVPARSSLLCLNVVGDAEGQPLHFSERLFPLPRFAGLEAVVRETGSITAGF
AAHGVDDYTRRDSRITAQMPEPTVAAHLRQPVSRPVLFVESVNVDTAAVPIEYARTWFAG
DRITLTVTHDE