Protein Info for GFF6254 in Variovorax sp. SCN45

Annotation: Phosphonate ABC transporter ATP-binding protein PhnC (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 98 to 110 (13 residues), see Phobius details TIGR02315: phosphonate ABC transporter, ATP-binding protein" amino acids 4 to 251 (248 residues), 307.6 bits, see alignment E=2.8e-96 PF00005: ABC_tran" amino acids 21 to 182 (162 residues), 104.9 bits, see alignment E=5.5e-34

Best Hits

Swiss-Prot: 70% identical to PHNC1_RHOFT: Phosphonates import ATP-binding protein PhnC 1 (phnC1) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 89% identity to vap:Vapar_6091)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>GFF6254 Phosphonate ABC transporter ATP-binding protein PhnC (TC 3.A.1.9.1) (Variovorax sp. SCN45)
MNTLLRIRQLNKHFANGRHALRDINIDVARGDMVALIGASGSGKSTLLRHIAGLVAADGS
SESLVEIDGRCVQKGGRIDRDIRKVRSQVGFVFQQFNLVARLPVLVNVLVGSLHRMPWWR
SWMRLFTAQERALALEALARVGIADCYAQRASTLSGGQQQRAAIARTLVQGAKVVLADEP
IASLDPESSRKVMEILARINREDGCTVIVSLHQVDIAMKYCPRVVALNQGQVVFDGPSSA
LTPELLRELYGVQAEELLRPEGTAVVPAPAQPVAGPWAQLPVQVA