Protein Info for GFF6250 in Variovorax sp. SCN45

Annotation: Glutamate--cysteine ligase-like protein YbdK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 TIGR02050: carboxylate-amine ligase, YbdK family" amino acids 47 to 330 (284 residues), 325.6 bits, see alignment E=1.4e-101 PF04107: GCS2" amino acids 47 to 386 (340 residues), 234.1 bits, see alignment E=1.6e-73

Best Hits

Swiss-Prot: 82% identical to GCS2_POLNA: Putative glutamate--cysteine ligase 2 (Pnap_3664) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K06048, carboxylate-amine ligase [EC: 6.3.-.-] (inferred from 96% identity to vpe:Varpa_0524)

Predicted SEED Role

"FIG074102: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 6.3.-.-

Use Curated BLAST to search for 6.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF6250 Glutamate--cysteine ligase-like protein YbdK (Variovorax sp. SCN45)
MSSSNSNTAATPVDPDSDDVRSAPLPADPESRMVKLEPFNKSEALSLGVELELQLVNTHD
YDLAPYAEDMLRLMAQTPLPGSVVPEMTSSMIEISTDICHSAQDVITQLSPIREALIRNA
DKLNIAVVGGGTHTFQQWHERRIYDKPRFRELSELYGYLSKQFTIFGQHVHIGCPDADAA
LLMLHRMSRYIPHFIALSASSPFVQGQDTQFDSARLNSVFAFPLSGRAPFTLSWKEFEAY
FERMTRTGVVRSMKDFYWDIRPKPEFGTIEIRVFDTPLTVERAAALAGYVQSLAAWFLQE
QPFEPTEDDYLVYTYNRFQACRFGLDAVYVDPASGQHMPLRDHILMTMTQLEWHSEALNA
TQALGELRTSVEANRNDARWLREKQGKERLLAEVVRQAALRFRGEA