Protein Info for GFF6229 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details PF00672: HAMP" amino acids 213 to 268 (56 residues), 29.4 bits, see alignment 1.6e-10 PF00512: HisKA" amino acids 299 to 361 (63 residues), 43.5 bits, see alignment E=5.3e-15 PF02518: HATPase_c" amino acids 407 to 517 (111 residues), 93.6 bits, see alignment E=2.2e-30 PF00072: Response_reg" amino acids 541 to 651 (111 residues), 49.8 bits, see alignment E=7e-17

Best Hits

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_0546)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>GFF6229 hypothetical protein (Variovorax sp. SCN45)
MSTAARPSEGTPQAVVVDDAAPEAVPAALPPPHTLIVRGNLQNDLFRLGVVPCAAVALAL
TGWFTHSRLQTLEAAFDAEGQAVARQVAAMSDLSLYAGDVPALQNVANAALRGGQVTRVE
ISNSAGVFVTAGPKTNSLARLRMFTSPVTLREASRASAFAPAGSTAAGDTPIGLVQTFRD
TTAYTRERSRSLIAGIGIAMVALIAAWASVRHMARTVARPLRRVSRTVAALEAGQFEVRC
GVVEGGTRGTHELAVLAHDIDRLAERLQHNRQVSEERVREATAVALQRMAEAEQAALSRA
RFLAAASHDLRQPLHAMGLFIDGLLPGATPAQRPAVLRLQESTEFMGVLLDDLLEISRLD
AQVLTPAITKVSLAALFDQIDAQHAATAAEARVRLHWSDRGLAVRTDAAMLRRIVGNLVS
NALRHAPDGGTVLVAARRCAAGVRIEVRDNGVGIAPIHQGRIFEEFYQVANTERDRRRGF
GLGLAICARIATLLGTRITVRSALQAGSTFAFTLPAARAADAVQPEPPQFAPTPLAGLRC
LVVDDDPAILDGSRTLLAQWGCQAECVTTGAEAIARLGGGDVHYDAVLCDLQLAGDDDGV
DVLDAAKRLQPDALAVLVSGATGPEVLQRLRQGGVMLLTKPVAPAKLRALLTTRRQVHAS