Protein Info for GFF6212 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF13412: HTH_24" amino acids 1 to 47 (47 residues), 44.3 bits, see alignment E=1.6e-15 PF13404: HTH_AsnC-type" amino acids 1 to 42 (42 residues), 46.9 bits, see alignment E=2.8e-16 PF01037: AsnC_trans_reg" amino acids 68 to 137 (70 residues), 65 bits, see alignment E=7.1e-22

Best Hits

Swiss-Prot: 30% identical to REG8_PYRAB: Uncharacterized HTH-type transcriptional regulator PYRAB04820 (PYRAB04820) from Pyrococcus abyssi (strain GE5 / Orsay)

KEGG orthology group: None (inferred from 76% identity to rme:Rmet_5648)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>GFF6212 Transcriptional regulator, AsnC family (Variovorax sp. SCN45)
MDDTDRELISLLRADARTPVVTLAKKLRLARATVQNRISRLESDGMIVGYTLRLKPEAEL
HRIRAFMTIEVDGHHGDEVGRVLRGNPNVVALHTTNGRWDLIAELRADNLESFDRVLNAI
RKIQGIANTETSILLSTHKL