Protein Info for GFF6196 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 134 to 162 (29 residues), see Phobius details amino acids 207 to 233 (27 residues), see Phobius details amino acids 253 to 278 (26 residues), see Phobius details PF12911: OppC_N" amino acids 19 to 66 (48 residues), 25.3 bits, see alignment 1.2e-09 PF00528: BPD_transp_1" amino acids 107 to 290 (184 residues), 114.4 bits, see alignment E=5.6e-37

Best Hits

Swiss-Prot: 40% identical to GSID_PECAS: Glutathione transport system permease protein GsiD (gsiD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 92% identity to vpe:Varpa_4344)

MetaCyc: 44% identical to glutathione ABC transporter membrane subunit GsiD (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF6196 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MNAITAPAPSAAALKLPGFWQRAVKHRSFVIGGVLAALLLIAALVSFVWTPWSPYAMDMA
NKMQAPTGSHWLGTDAFGRDVASLLLVGARASILVGIIAVGIGLVVGTALGLLAAAKRGW
VEEAVMRLSDFTLAFPAILSAIMMTAVFGAGIVNAIVAIGIYNIPTFARITRASANAIWS
REYVAAARACGKGSFAITMQHVLPNISAVLIVQITIRFAIAILAEAALSYLGLGTQPPQP
SWGRMLSEAQTLMFQQPLLAVFPGMAIALAVLGLNLLGDGLRDLLDPRLARAR