Protein Info for GFF6188 in Variovorax sp. SCN45

Annotation: 3-demethylubiquinol 3-O-methyltransferase (EC 2.1.1.64) @ 2-polyprenyl-6-hydroxyphenyl methylase (EC 2.1.1.222)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 11 to 229 (219 residues), 273.2 bits, see alignment E=7.1e-86 PF06325: PrmA" amino acids 33 to 155 (123 residues), 34.9 bits, see alignment E=6.2e-12 PF08003: Methyltransf_9" amino acids 45 to 154 (110 residues), 28.8 bits, see alignment E=3.1e-10 PF13489: Methyltransf_23" amino acids 49 to 205 (157 residues), 94.3 bits, see alignment E=3.5e-30 PF05175: MTS" amino acids 50 to 122 (73 residues), 26.5 bits, see alignment E=2.2e-09 PF01209: Ubie_methyltran" amino acids 50 to 157 (108 residues), 37.1 bits, see alignment E=1.2e-12 PF13847: Methyltransf_31" amino acids 52 to 156 (105 residues), 61.1 bits, see alignment E=5.5e-20 PF02353: CMAS" amino acids 53 to 161 (109 residues), 33.8 bits, see alignment E=1.2e-11 PF13649: Methyltransf_25" amino acids 54 to 148 (95 residues), 71.3 bits, see alignment E=4.6e-23 PF08242: Methyltransf_12" amino acids 55 to 150 (96 residues), 68.4 bits, see alignment E=3.7e-22 PF08241: Methyltransf_11" amino acids 55 to 152 (98 residues), 78.9 bits, see alignment E=1.8e-25

Best Hits

Swiss-Prot: 79% identical to UBIG_RHOFT: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 94% identity to vpe:Varpa_1784)

MetaCyc: 53% identical to bifunctional 3-demethylubiquinol 3-O-methyltransferase/polyprenyldihydroxybenzoate methyltransferase (Xanthomonas campestris pv. campestris)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; Hexaprenyldihydroxybenzoate methyltransferase. [EC: 2.1.1.64, 2.1.1.114]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.114 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF6188 3-demethylubiquinol 3-O-methyltransferase (EC 2.1.1.64) @ 2-polyprenyl-6-hydroxyphenyl methylase (EC 2.1.1.222) (Variovorax sp. SCN45)
MTENVNADPAELAKFSELAHRWWDLESEFRPLHEINPLRLEWIDGIAPISQRRVLDIGCG
GGILADSMARKGAEVLGIDLAGKALKVAQLHALEAGTRSVKYREISAEALAAQQPGSFDV
VTCMEMLEHVPQPASVIQACAALVKPGGWVFFSTINRNLKSFMLAIVGAEYVLGMLPRGT
HEYAKLIRPSELAAYCRAAGLDLRHTRGMEHNPLTRRYWLSGDTSVNYMFATQKPGAPA