Protein Info for GFF6174 in Variovorax sp. SCN45

Annotation: Fluoride ion transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 89 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details PF02537: CRCB" amino acids 6 to 117 (112 residues), 89.7 bits, see alignment E=7.1e-30 TIGR00494: protein CrcB" amino acids 6 to 117 (112 residues), 83.4 bits, see alignment E=7.6e-28

Best Hits

Swiss-Prot: 78% identical to CRCB_ACIAC: Putative fluoride ion transporter CrcB (crcB) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K06199, CrcB protein (inferred from 78% identity to aav:Aave_3300)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>GFF6174 Fluoride ion transporter CrcB (Variovorax sp. SCN45)
MLLNALVICLAACVGALMRWGFATWLNPGGVLPWGTLAVNLIGGYLIGIAIGVFNGLPDI
DPAWRLMVITGFLGTLTTFSSFSAEIVGMLMNGRLGLALATLMLHLGGSLCLTWLGFRTV
QAFSA