Protein Info for GFF6145 in Variovorax sp. SCN45

Annotation: 2-aminoethylphosphonate utilization transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03338: phosphonate utilization associated transcriptional regulator" amino acids 9 to 218 (210 residues), 312.2 bits, see alignment E=8.4e-98 PF00392: GntR" amino acids 24 to 80 (57 residues), 55.9 bits, see alignment E=4.1e-19 PF13412: HTH_24" amino acids 40 to 71 (32 residues), 23.5 bits, see alignment 5.1e-09 PF07729: FCD" amino acids 90 to 213 (124 residues), 105.2 bits, see alignment E=4.9e-34

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_1736)

Predicted SEED Role

"Predicted regulator PutR for proline utilization, GntR family" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>GFF6145 2-aminoethylphosphonate utilization transcriptional regulator, GntR family (Variovorax sp. SCN45)
MVTSNHSAALAFLQSSSLPMLMQEEIERLIMTGELPVGSRINESELSQRFNTSRGPIREA
LRALEEAGLVRNEKNRGVFVREIAFEEADEIYELREALEEIIGRRVALAIKPDAIERLRA
MLDAMRSAAQAQDVEQYAQLNLQFHEILLDTAGSKKLTETYKRLVKELHLFRMRALDSGG
GLRVSADEHRVIVDAIASGNPDIAGQALRKHVADSRARMHKAFGRTDPAPIAAPNNPPQK
EV