Protein Info for GFF6141 in Variovorax sp. SCN45

Annotation: 2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR02326: 2-aminoethylphosphonate--pyruvate transaminase" amino acids 7 to 363 (357 residues), 519 bits, see alignment E=6.7e-160 TIGR03301: 2-aminoethylphosphonate aminotransferase" amino acids 8 to 361 (354 residues), 497.3 bits, see alignment E=3e-153 PF00266: Aminotran_5" amino acids 27 to 318 (292 residues), 80 bits, see alignment E=9e-27

Best Hits

Swiss-Prot: 81% identical to PHNW2_BURL3: 2-aminoethylphosphonate--pyruvate transaminase 2 (phnW2) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K03430, 2-aminoethylphosphonate-pyruvate transaminase [EC: 2.6.1.37] (inferred from 96% identity to vpe:Varpa_1732)

MetaCyc: 66% identical to 2-aminoethylphosphonate aminotransferase monomer (Pseudomonas aeruginosa)
2-aminoethylphosphonate--pyruvate transaminase. [EC: 2.6.1.37]

Predicted SEED Role

"2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37)" in subsystem Phosphonate metabolism (EC 2.6.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>GFF6141 2-aminoethylphosphonate:pyruvate aminotransferase (EC 2.6.1.37) (Variovorax sp. SCN45)
MSQADYPILLTPGPLTTSDRTRNAMLRDWGSWDADFNQITARIRKEVLNIVHGTGTHECV
PLQGSGTFSVEAAIGTVVPRNGHVLVPSNGAYCQRLAKICKVLGRKLSTIDYTEEKQVSP
ADVDRALAADPSITHVAVVHCETGAGVLNPLHEIALVVARHGRGLIIDAMSSFGAIEIDA
RKTPFDAVVAASGKCLEGVPGMGFVVIKRSTLEKCEGNCHSLSMDLYDQWVYMEKTTQWR
FTPPTHVVAALDTAIAQYIEEGGLKARGARYARNCKGLIDGLAALGFRSFLDPAIQAPII
ITFHAPDDANYDFKTFYQEVKKRGYILYPGKLTQVETFRVGCMGHFGEAGIPGAVAAIAE
TLEAMGIRQVSVPVAA