Protein Info for GFF614 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Osmolarity sensory histidine kinase EnvZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details PF00672: HAMP" amino acids 174 to 223 (50 residues), 32.6 bits, see alignment 1.2e-11 PF00512: HisKA" amino acids 231 to 287 (57 residues), 46.2 bits, see alignment 5.8e-16 PF02518: HATPase_c" amino acids 331 to 436 (106 residues), 87.4 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 100% identical to ENVZ_SALTY: Osmolarity sensor protein EnvZ (envZ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 99% identity to ses:SARI_04114)

MetaCyc: 96% identical to sensor histidine kinase EnvZ (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>GFF614 Osmolarity sensory histidine kinase EnvZ (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
LEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS
VLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
SHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG
TSERGGLSIRAWLPVPVARVQGTTKEA