Protein Info for GFF6137 in Variovorax sp. SCN45

Annotation: TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 7 to 54 (48 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 105 to 135 (31 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 333 to 349 (17 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 430 to 436 (7 residues), see Phobius details amino acids 444 to 473 (30 residues), see Phobius details amino acids 500 to 523 (24 residues), see Phobius details PF06808: DctM" amino acids 14 to 524 (511 residues), 306.1 bits, see alignment E=1.9e-95

Best Hits

KEGG orthology group: None (inferred from 92% identity to vpe:Varpa_1728)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (612 amino acids)

>GFF6137 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6 (Variovorax sp. SCN45)
MEFIVANFAPIMFAGLICFLLLGYPVAFSLGACGLFFGLVGIELGVFQSSVMAWLPQRLI
GIMANDTLLAVPFFTLMGLILERSGMAEDLLDTVGQVFGPMRGGLALAVIFVGALLAATT
GVVAASVISMGLISLPIMLRYGYDRRLSSGVIAASGTLAQIIPPSLVLIIMADQLGKSVG
DMYKGAFLPGFMLMGLYVVYVVFLAIFRPAQVPALPPEARTFREPNGSGGYTSLVALAAL
SAVVAVWLARNMAAVHTWFQGQEVTSVATDEKVVVAMCGGVFVALVIALINKGLKLNLLS
RLAERVTFVLIPPLLLIFLVLGTIFLGVATPTEGGAMGALGALIMAWVRRRMSLALLKQA
LASTTKLSSFVMFILIGATVFSLVFQAADGPIWVEHLLSSLPGGPVGFLIAVNVLVFFLA
FFLDYFELSFIVVPLLAPVAHKLGIDLIWFGVLLAVNMQTSFMHPPFGFALFFLRSVAPD
KQYVDRVTQKVMEPVTTMQIYRGAVPFVLIQLTMVGVLIAFPQIVTGALDKEVKVNLDDI
GAQMRDSLKQEDGAPGADPYGGPEDAAPPGAEPQPGAEGAAPTPAPEPAPAESGESDPMK
AMQDALKQQNKP