Protein Info for GFF6135 in Variovorax sp. SCN45

Annotation: ABC transporter, substrate-binding protein (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 27 to 347 (321 residues), 74.5 bits, see alignment E=1.4e-24 PF13458: Peripla_BP_6" amino acids 27 to 358 (332 residues), 204 bits, see alignment E=8.2e-64 PF01094: ANF_receptor" amino acids 48 to 354 (307 residues), 95 bits, see alignment E=7.7e-31

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 80% identity to rsl:RPSI07_mp0014)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF6135 ABC transporter, substrate-binding protein (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MRLPNSFKPALLAFAAATAFGAQAADIKIGVAAALSGGAAQYGSAIRNGFQLAADEINAA
GGINGDKIVLAVEDEQGKKEDAINVFKKLIFQDKVLMTFGPTLSNSAQAADPIAQAAKTV
AFGTSNTADGITSIGDYVFRNSVTEADVLPETLRVAIKHANVKKVAVLYGNDDVFTKSGY
DNFKKALEDLKLPVTTTETFAKGDVDFKAQLTKIKATNPDAIVLSALLAEGAPIMVQARQ
LGLNVPVIGGNGMNSTKIFDLAKGSSDNLYVGSPWSASNATPENTKFQKAYNDKFKMAPD
QFAAQAYDGLYVVAQALKGVKLSGNLAADRTALRDALPNVKWTGATGAFAFARAKDKAGK
PAGYDAQQTAIVSVTKGTAFVIEK