Protein Info for GFF6132 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF13476: AAA_23" amino acids 9 to 57 (49 residues), 28.1 bits, see alignment 6e-10 PF00005: ABC_tran" amino acids 22 to 183 (162 residues), 118.4 bits, see alignment E=7.7e-38 PF12399: BCA_ABC_TP_C" amino acids 231 to 256 (26 residues), 45.1 bits, see alignment (E = 1.2e-15)

Best Hits

Swiss-Prot: 47% identical to LIVG_SHIFL: High-affinity branched-chain amino acid transport ATP-binding protein LivG (livG) from Shigella flexneri

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 74% identity to rpi:Rpic_3796)

MetaCyc: 47% identical to branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivG (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF6132 ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MSDNTLLTLKNVSRHFGGLKVLQDVNLDIPKGGIFGLIGPNGAGKTTVFNLITGLLPTTS
GTIHFQGQDLAGRKPFQITRGGIARTFQNIRIFKEMSLLENVTVGMDAKLRYGPLGLLAS
TGMFRSEEKRARDRARELLSWVKLDHKANDVADNLSYGDQRKLELARALATEPTLLLLDE
PVAGMNSTEKSELMVEIENIAARGFTVFMIEHDMRFVMGLCQQIAVLNFGRIIARGGPEQ
IRNDPQVIEAYLGREDDEATNDQETAA