Protein Info for GFF6122 in Variovorax sp. SCN45

Annotation: ABC-type antimicrobial peptide transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 291 to 314 (24 residues), see Phobius details amino acids 334 to 364 (31 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 205 (186 residues), 49.6 bits, see alignment E=6.5e-17 PF02687: FtsX" amino acids 293 to 411 (119 residues), 58.1 bits, see alignment E=9.6e-20

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 98% identity to vpe:Varpa_1718)

Predicted SEED Role

"ABC-type antimicrobial peptide transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>GFF6122 ABC-type antimicrobial peptide transport system, permease component (Variovorax sp. SCN45)
MKALFSIAWRSAWNRRFTLALTVFSIALSTFLLLGVERIRTELRENFASSVSGTDLIVGA
RTGSTQLLLYSVFRIGAATNNISWKSVQALEAHPGVDWVVPLSLGDSHRGFAVLATSPEY
FTRFRYGDRQLLKMREGKPFSELFDAVVGAEVADKLGYHVGQKITLAHGSGELNVAEHAD
KPFTVVGVLARTGTPVDRTVHIGLPAMEAIHLEWVGGAPMPGVHIPAEQVRKFDLTPKNV
TAALVGLKNRAAVFGVQRWISTYTGEPLMAILPGVALDELWSVIGIGENALLLMSALVAL
VSLAGLVSVVMAGLNERRRELAVLRAVGAGLRHVLALLALEGAMVTVLGVAFGVVMAVLG
IALLSPWLQAQFGLTLSLSEPTLNEWLLMASLLVAGWLASLLPGIRAYRLSLADGLSPRI