Protein Info for GFF611 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcription accessory protein (S1 RNA-binding domain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 PF09371: Tex_N" amino acids 6 to 77 (72 residues), 103.5 bits, see alignment E=1.4e-33 PF22706: Tex_central_region" amino acids 134 to 311 (178 residues), 253.2 bits, see alignment E=5.5e-79 PF16921: Tex_YqgF" amino acids 328 to 451 (124 residues), 171.5 bits, see alignment E=3.6e-54 PF14635: HHH_7" amino acids 464 to 556 (93 residues), 38.3 bits, see alignment E=5.1e-13 PF12836: HHH_3" amino acids 491 to 555 (65 residues), 102.2 bits, see alignment E=4.4e-33 PF17674: HHH_9" amino acids 561 to 630 (70 residues), 85.8 bits, see alignment E=1e-27 PF00575: S1" amino acids 651 to 720 (70 residues), 84.3 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 94% identical to YHGF_ECOLI: Protein YhgF (yhgF) from Escherichia coli (strain K12)

KEGG orthology group: K06959, uncharacterized protein (inferred from 95% identity to cko:CKO_04829)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (776 amino acids)

>GFF611 Transcription accessory protein (S1 RNA-binding domain) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMNDSFCRIIAGEIQANAGQVEAAVRLLDEGNTVPFIARYRKEITGGLDDTQLRNLETRL
GYLRELEDRRQAILKSISEQGKLTDELAGAINATLSKTELEDLYLPYKPKRRTRGQIAIE
AGLEPLADLLWNEPSHDPDVEAAKYIDGDKGVADTKAALDGARYILMERFAEDAALLAKV
RDYLWKNAHLVATVVSGKEEEGAKFRDYFDHHEPIANVPSHRALAMFRGRNEGILQLSLN
ADPQFDEPPKESYCEQIIMDHLGLRLNNAPADSWRKGVVSWTWRIKVLMHLETELMGTVR
ERAEDEAINVFARNLHDLLMAAPAGLRATMGLDPGLRTGVKVAVVDGTGKLVATDTIYPH
TGQAAKAATVIAALCEKYHVELVAIGNGTASRETERFYLDVQKQFPNVTAQKVIVSEAGA
SVYSASELAAQEFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSQTQLA
RKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQNIVAWRDENGQFQNRQQLLKVS
RLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVERILAATQQALKDLMGNSNELRHL
KAADFTDDKFGVPTVSDIIKELEKPGRDPRPEFKTAQFADGVETMNDLLPGMILEGAVTN
VTNFGAFVDIGVHQDGLVHISSLSTKFVDDPHTVVKAGDIVKVKVLEVDLQRKRIALTMR
LDEQPGETAARRGGGADRAQGNRPASKAAKPRGRDAQPAGNSAMMDALAAAMGKKR