Protein Info for GFF6107 in Variovorax sp. SCN45

Annotation: Zinc transporter, ZIP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF02535: Zip" amino acids 4 to 266 (263 residues), 107.2 bits, see alignment E=5.3e-35

Best Hits

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_1696)

Predicted SEED Role

"Zinc transporter, ZIP family" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF6107 Zinc transporter, ZIP family (Variovorax sp. SCN45)
MNLIVIIVATLVAGIGSVWLAALLLKVGVRSDSGGVNPQHLLSLAAGALLATAFMHLLPE
AFESRIEPALLFAVLLFGLVFFFLLDKAELWHHGHEHHHGGEPDAHAGHGHGHDHGHGHS
HDNTPRTGGWAVLTGDSVHCFGDGILIASAFTADIRLGLVAAIAVLAHEIPHHIGDLVVL
RQSSANQRAALVKVSLAGTMTTLGGIAGWWLVDQLHSWLPYFLVLAGSSFVYVALADLIP
QLQKRLPARQTAAQILWLAAGIVLVTGVSRLAHGEHGHDHGHDDPGHGEHGHVHKD