Protein Info for GFF6095 in Variovorax sp. SCN45

Annotation: 1,2-phenylacetyl-CoA epoxidase, subunit C (EC 1.14.13.149)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05138: PaaA_PaaC
  • amino acids 4 to 259 (256 residues), 323.5 bits, E=4.7e-101
• TIGR02158: phenylacetate-CoA oxygenase, PaaI subunit
  • amino acids 20 to 259 (240 residues), 296.5 bits, E=8.7e-93

Best Hits

Swiss-Prot: 48% identical to PAAC_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit C (paaC) from Escherichia coli (strain K12)

KEGG orthology group: K02611, phenylacetic acid degradation protein (inferred from 94% identity to vpe:Varpa_1326)

MetaCyc: 48% identical to phenylacetyl-CoA 1,2-epoxidase, structural subunit (Escherichia coli K-12 substr. MG1655)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaI subunit"

MetaCyc Pathways

• phenylacetate degradation I (aerobic) (8/9 steps found)
• superpathway of phenylethylamine degradation (9/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Protein Sequence (259 amino acids)

>GFF6095 1,2-phenylacetyl-CoA epoxidase, subunit C (EC 1.14.13.149) (Variovorax sp. SCN45)
MQASIELNRTPAVQYLLRIGDTCLVLAQRLGEWCGHAPVLEEDIAMANIALDLVGQARAL
LTHAGKLEGAGREHDEDQLAYLRDERDYFNLTIAELPRGDFAFAVVRNTMVSTLLKLLWQ
RLAASSDAEVAAIAGKALKEARYHQQHSADWMVRLGDGTEESRRRIEKALKRLWLYMPEL
FESDAVDAEASASGLGPAWSELREPWLADMQQVLDAAGLAMPKEAAFRSTGKQGVHSEHM
GYILAEMQHLQRSFPGGVW