Protein Info for PS417_03095 in Pseudomonas simiae WCS417

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF00437: T2SSE" amino acids 85 to 366 (282 residues), 230.6 bits, see alignment E=2.5e-72 PF27713: UCP018868" amino acids 188 to 321 (134 residues), 38.2 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: K02283, pilus assembly protein CpaF (inferred from 99% identity to pfs:PFLU0645)

Predicted SEED Role

"Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9M5 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PS417_03095 ATPase (Pseudomonas simiae WCS417)
MNGEKLFGGPARSASGSTDNDGLKLVLHRYIIDAIEESGKNLLEGTRQSLAQFVIDKVSE
YITRMRLAISRYEMERLAEEIVDELTGFGPLEVLLRDPSVTEILVNGPHRVFIERDGLLH
QSDLRFIDDHHVERVMQRILAPLGRRLDESSPMVDARLPDGSRVNAIIPPIALDGPCLSI
RKFRKDMLKSTDLVAMQTIDQSIFEFFQEAVGKRCNILISGGTGTGKTTLLNILSQLINP
HERLVTIEDVAELQLGHPHVVRLETRPPNAEGHGEVRSSDLIRNALRMRPDRIILGEIRG
VEVLDVMTAMNTGHDGSMSTVHANNAQDALLRLETLVGLTGRVIAEKTLRQMICAALDVI
IQLTRMPDGRRCVSEVVEVVGVRDDVYVTNTLFRLDRRTGFGFLREALNPAGDKLRREST
LQS