Protein Info for GFF6067 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 144 (133 residues), 75.3 bits, see alignment E=3.1e-25 amino acids 159 to 300 (142 residues), 59.7 bits, see alignment E=2e-20

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_1357)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>GFF6067 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MQTQPQRLTPLTVFLLVVPPLLWAGNAVVGRLVRELVSPLTLNFVRWVIAFLIVLPLAAP
VLRRGSPLWPHWRRYALLGLLGIGLYNAFQYLALQTSTPINVTLVGSSVPLWMLATGALF
FGARISAREVGGALLSMAGVLLVLSRGEWRQLMALRLVPGDLYMILGSIAWAFYSWMLAR
THEPKDVRQDWSAFLMAQLVFGIGWSGALAAGEWTLTDAHIDLGWPLLAAMLFIGIGPAV
LAYRCWGTGVQRAGPQAASIFMNLTPLFAAVLSAAFLRELPHWYHGAAFVLIVGGIVVSS
RR