Protein Info for GFF6057 in Variovorax sp. SCN45

Annotation: ABC-type Fe3+ transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13531: SBP_bac_11" amino acids 46 to 285 (240 residues), 59.8 bits, see alignment E=5.1e-20 PF01547: SBP_bac_1" amino acids 48 to 280 (233 residues), 47.6 bits, see alignment E=3.5e-16 PF13343: SBP_bac_6" amino acids 76 to 300 (225 residues), 155.9 bits, see alignment E=2e-49

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 94% identity to vpe:Varpa_1366)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>GFF6057 ABC-type Fe3+ transport system, periplasmic component (Variovorax sp. SCN45)
MSSRFHRLARLGLLAATLAAGSAMAQTAICYNCPTEWADWGTQLKAIKAKTGVTVPPDNK
NSGQSLAQMAAEKASPVADVTYLGVTFAVQAAKDGLVEPYKPAAWKDIPDGLKDPAGNWF
TIHSGTLGFMVNVDALKGKPVPKSWADLLKPEYKGLIGYLDPASAFVGYVGAVAVNEARG
GTLDNFKPAIDYFKALQKNEPIVPKQTSYARVLSGEIAILLDYDFNAYRAKYKDKANVAF
VIPSEGTLAVPYVMSLVAKAPHAADAKKVLDFTLSDEGQAIWAKAYLRPVRASAMPKEIE
AQFLPASEYARAKSVDYGRMAAAQKAFSDEYLKEVR