Protein Info for GFF6055 in Variovorax sp. SCN45

Annotation: Lipoprotein signal peptidase (EC 3.4.23.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 23 to 164 (142 residues), 138.5 bits, see alignment E=9.8e-45 PF01252: Peptidase_A8" amino acids 23 to 163 (141 residues), 142.2 bits, see alignment E=7e-46

Best Hits

Swiss-Prot: 80% identical to LSPA_POLSJ: Lipoprotein signal peptidase (lspA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 94% identity to vap:Vapar_1267)

MetaCyc: 48% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>GFF6055 Lipoprotein signal peptidase (EC 3.4.23.36) (Variovorax sp. SCN45)
MAAARSMSASRSRGGSIWPWLGLAVIIVIIDQFTKTLILGYYKLGDATYVTSFFNVVRAH
NTGAAFSFLADHSGWQRWLFTAIGVGAAVFIVWMLKSHAGQKLFSFSMACILGGAVGNVV
DRMMHGYVVDFLSFHAGNWYFPAFNAADSAITLGAICLILDEIRRVRRGK