Protein Info for GFF605 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Biotin synthesis protein BioH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 1 to 226 (226 residues), 120 bits, E=2.1e-38
• PF12697: Abhydrolase_6
  • amino acids 1 to 232 (232 residues), 70.2 bits, E=6.1e-23
• TIGR01738: pimelyl-[acyl-carrier protein] methyl ester esterase
  • amino acids 1 to 236 (236 residues), 362.7 bits, E=5.1e-113
• PF12146: Hydrolase_4
  • amino acids 2 to 196 (195 residues), 34 bits, E=3e-12

Best Hits

Swiss-Prot: 100% identical to BIOH_SALHS: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Salmonella heidelberg (strain SL476)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 99% identity to see:SNSL254_A3783)

MetaCyc: 81% identical to pimeloyl-acyl carrier protein methyl ester esterase (Escherichia coli K-12 substr. MG1655)
RXN-11483 [EC: 3.1.1.85]; Carboxylesterase. [EC: 3.1.1.85, 3.1.1.1]

Predicted SEED Role

"Biotin synthesis protein BioH"

MetaCyc Pathways

• biotin biosynthesis I (15/15 steps found)
• 8-amino-7-oxononanoate biosynthesis I (11/11 steps found)
• methylsalicylate degradation (2/2 steps found)
• aspartame degradation (1/2 steps found)
• methyl indole-3-acetate interconversion (1/2 steps found)
• superpathway of methylsalicylate metabolism (1/5 steps found)
• retinol biosynthesis (1/7 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Drug metabolism - other enzymes

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1 or 3.1.1.85

Protein Sequence (240 amino acids)

>GFF605 Biotin synthesis protein BioH (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VLLHGWGLNAEVWHCIREELGSHFTLHLVDLPGYGRSSGFGAMTLEEMTAQVAKNAPDQA
IWLGWSLGGLVASQMALTHPERVQALVTVASSPCFSAREGWPGIKPEILGGFQQQLSDDF
QRTVERFLALQTLGTETARQDARTLKSVVLAQPMPDVEVLNGGLEILKTVDLREALKNVN
MPFLRLYGYLDGLVPRKIVPLLDTLWPHSTSQIMAKAAHAPFISHPAAFCQALMTLKSSL