Protein Info for GFF6047 in Variovorax sp. SCN45

Annotation: Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00551: Formyl_trans_N
  • amino acids 2 to 186 (185 residues), 194.3 bits, E=7.9e-62
• TIGR00639: phosphoribosylglycinamide formyltransferase
  • amino acids 2 to 193 (192 residues), 224.4 bits, E=4.4e-71

Best Hits

Swiss-Prot: 36% identical to PUR3_BACSU: Phosphoribosylglycinamide formyltransferase (purN) from Bacillus subtilis (strain 168)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 92% identity to vap:Vapar_1275)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.2

Protein Sequence (198 amino acids)

>GFF6047 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (Variovorax sp. SCN45)
MKNIVILISGGGSNMAAIVRAAERDRWAERFGARIAAVVSNKADAGGLAIARSHGIDTAV
VPHKEFATREAFDEALATVVDAHSPALVVLAGFMRILTPGFVGRYAGRLVNIHPSLLPAF
PGLHTHQRAIEAGCKVAGVTVHQVTTELDHGPILAQAVVPVLPGDTAASLAGRVLAQEHL
LYPRAIAEWLADTSRHNP