Protein Info for GFF604 in Variovorax sp. SCN45

Annotation: Tricarballylate utilization protein, TcuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 131 to 153 (23 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 332 to 349 (18 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details TIGR02484: CitB domain protein" amino acids 35 to 400 (366 residues), 419.9 bits, see alignment E=4.9e-130

Best Hits

Swiss-Prot: 67% identical to CITB_ECOLX: Citrate utilization protein B (citB) from Escherichia coli

KEGG orthology group: K13795, citrate/tricarballylate utilization protein (inferred from 88% identity to vap:Vapar_3134)

Predicted SEED Role

"TcuB: works with TcuA to oxidize tricarballylate to cis-aconitate" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>GFF604 Tricarballylate utilization protein, TcuB (Variovorax sp. SCN45)
LQQLTELVARARADAEGAPAPRVIPIAPALPLTAGEEEVARILQICNACRYCEGFCAVFP
AMTRRLEFDKADTHYLANLCHNCGACLHACQYAPPHEFAVNVPQAMARVRMQTYHDYAWP
PAMGALYRRAGLAVALALAGGLALFLVLAVAMSGSLLHAPLAGNFYAIFPHNFLALLFGA
VSLFVVLALGMGARRFWREVSPAVDNPPSAVAGVRAAAGAEAAHDALRLKYLGGGHGEGC
NNEDDRFSLWRRRFHHFTFYGFMLCFAATCVATLYHYLLGLHAPYALTSLPVLLGSAGGI
GLVIGPVGLLWLNLRRDPAHGDVAQRPMDRGFIVLLLLTSLTGLALLAWRDTRFMGLLLA
VHLGVVMALFLTLPYGKFAHGIFRSAALLKFAIEKRLPSRLQLGAD