Protein Info for GFF604 in Sphingobium sp. HT1-2

Annotation: Protein PhnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 PF03831: YjdM" amino acids 33 to 99 (67 residues), 99.8 bits, see alignment E=3.1e-33

Best Hits

Swiss-Prot: 47% identical to YJDM_ECOL6: Protein YjdM (yjdM) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06193, phosphonoacetate hydrolase [EC: 3.11.1.2] (inferred from 93% identity to sjp:SJA_C1-07570)

Predicted SEED Role

"Alkylphosphonate utilization operon protein PhnA" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>GFF604 Protein PhnA (Sphingobium sp. HT1-2)
MADDDYVYDEASGEWISAADAAARAGAGDAVEVRDSVGNLLADGDQVTLIKDLVVKGAGQ
TLKRGTLIKSIRLTGDAQEIDCRYDGIKGLVLRAEFVRKR