Protein Info for GFF6034 in Variovorax sp. SCN45

Annotation: Replication-associated recombination protein RarA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 PF05496: RuvB_N" amino acids 13 to 126 (114 residues), 43.4 bits, see alignment E=1.1e-14 PF07728: AAA_5" amino acids 46 to 131 (86 residues), 25.5 bits, see alignment E=4.1e-09 PF00004: AAA" amino acids 47 to 155 (109 residues), 54.4 bits, see alignment E=6.6e-18 PF16193: AAA_assoc_2" amino acids 181 to 254 (74 residues), 81 bits, see alignment E=2.2e-26 PF12002: MgsA_C" amino acids 255 to 421 (167 residues), 229.1 bits, see alignment E=1e-71

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 95% identity to vpe:Varpa_1388)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>GFF6034 Replication-associated recombination protein RarA (Variovorax sp. SCN45)
LATSAHQPLAERLRPRTLGEVIGQQHLLGPGMSLRIAFESGQPHSCILWGPPGTGKTTIA
RLMADAFDAQFLSISAVLGGVKDIREAVDLATAARDGLTQQRTIVFVDEVHRFNKSQQDA
FLPHVESGLFTFIGATTENPSFEVNSALLSRAAVYVLQSLNEDDLKQIVTRAQDIQAVPA
IDTAAVDRLVAYADGDARRLLNTLETLAVAARAEKLSNISDEWLLRVLGERMRRYDKGGE
QFYDTISALHKSVRGSDPDAALYWFVRMLDGGADPRYMARRLVRMASEDIGLADPRALRL
ALDAAEVYERLGTPEGELALAECVVYLAIAPKSNAVYKAYNAVRALVKKDSTRPVPMHLR
NAPTKLMKELDYGKGYRYAHDEEGGFAAGERYLPDGLEGQVFYEPVDRGLEIRIGEKLRE
LRRLNAEGND