Protein Info for GFF6032 in Variovorax sp. SCN45

Annotation: Branched-chain amino acid ABC transporter, permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 52 (23 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 240 to 263 (24 residues), see Phobius details amino acids 275 to 302 (28 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 34 to 338 (305 residues), 161.5 bits, see alignment E=1.2e-51

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 97% identity to vpe:Varpa_1390)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>GFF6032 Branched-chain amino acid ABC transporter, permease protein LivM (TC 3.A.1.4.1) (Variovorax sp. SCN45)
MKNSKNLALYIVGAIAVLALPLLLQMQGNAWVRIADIALLYVLLALGLNIVVGYAGLLDL
GYVAFFAVGAYLFALMGSSHLTETFPWFAQMFPNGMHTSLLIVIPLALVVAGCLGVLLGA
PTLKLRGDYLAIVTLGFGEIIRVFLNNLDQPVNITNGPKGITAIDSIKFWGLDLGKAWKF
DGFTISSVSLYYYLFLALVVATVIISHRLQTSRIGRAWMAIREDEIAAKAMGINTRNMKL
LAFGMGASFGGVSGAMFAAFQGFVSPESFSLMESVMIVAMVVLGGIGHLPGVILGAVLLA
ALPEVLRYVAGPLQAATDGRLDASILRQLFIALAMIVIMLLRPRGLWPSPEHGKTLARKG
GVPVDPAHAAVAPGSLQTHAPGIDTPADELPGAASRPMSINP