Protein Info for GFF6023 in Variovorax sp. SCN45

Annotation: UPF0033 protein RGE_33990

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01206: TusA
  • amino acids 5 to 73 (69 residues), 79.7 bits, E=5.7e-27

Best Hits

Swiss-Prot: 63% identical to TUSA_ALLVD: Sulfur carrier protein TusA (tusA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_1298)

MetaCyc: 63% identical to TusA sulfur-carrier protein (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

• sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)

Protein Sequence (75 amino acids)

>GFF6023 UPF0033 protein RGE_33990 (Variovorax sp. SCN45)
VQVDRELDTRGLNCPLPILKAKKSLNEMASGQLLKVVSTDPGSIRDFQAFARQTGNELME
QETVGTDFIHVLKRR