Protein Info for GFF602 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: High-affinity gluconate transporter GntT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 52 to 76 (25 residues), see Phobius details amino acids 97 to 154 (58 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 337 to 369 (33 residues), see Phobius details amino acids 376 to 394 (19 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details PF02447: GntP_permease" amino acids 1 to 437 (437 residues), 622.9 bits, see alignment E=2.8e-191 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 1 to 438 (438 residues), 667.4 bits, see alignment E=5.3e-205 PF03600: CitMHS" amino acids 14 to 384 (371 residues), 60.2 bits, see alignment E=1.9e-20

Best Hits

Swiss-Prot: 98% identical to GNTT_ECOLI: High-affinity gluconate transporter (gntT) from Escherichia coli (strain K12)

KEGG orthology group: K06155, Gnt-I system high-affinity gluconate transporter (inferred from 99% identity to ses:SARI_04102)

MetaCyc: 98% identical to high-affinity gluconate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-209

Predicted SEED Role

"High-affinity gluconate transporter GntT" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF602 High-affinity gluconate transporter GntT (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPLVIVAIGVILLLLLMIRFKMNGFIALVLVALAVGLMQGMPLDKVIGSIKAGVGGTLGS
LALIMGFGAMLGKMLADCGGAQRIATTLIAKFGKKHIQWAVVLTGFTVGFALFYEVGFVL
MLPLVFTIAAAANIPLLYVGVPMAAALSVTHGFLPPHPGPTAIATIFHADMGKTLLFGTI
LAIPTVILAGPVYARFLKGIDKPIPEGLYSAKTFTEEEMPGFGVSVWTSLVPVILMAMRA
IAEMILPKGHAFLPVAEFLGDPVMATLIAVLIAMFTFGLNRGRSMDQINDTLVSSIKIIA
MMLLIIGGGGAFKQVLVDSGVDKYIASMMHETNVSPLLMAWSIAAVLRIALGSATVAAIT
AGGIAAPLIATTGVSPELMVIAVGSGSVIFSHVNDPGFWLFKEYFNLTIGETIKSWSMLE
TIISVCGLIGCLLLGMVV