Protein Info for GFF6016 in Variovorax sp. SCN45

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00106: adh_short" amino acids 5 to 200 (196 residues), 128 bits, see alignment E=4.9e-41 PF08659: KR" amino acids 7 to 175 (169 residues), 70.8 bits, see alignment E=2.2e-23 PF13561: adh_short_C2" amino acids 59 to 254 (196 residues), 122 bits, see alignment E=4.8e-39

Best Hits

KEGG orthology group: None (inferred from 91% identity to vap:Vapar_1305)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF6016 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Variovorax sp. SCN45)
MVEGKVVVVTGAGGGIGRDIALAMAAHGAKVVVNDIGAALDGALDAEGGGPTRGAGPAQQ
VVDEIRAAGGQAAPNTDNVADAASAARIIQCALDSFGRIDAVVNNAGILRDRFFHKMSVD
EWDSVLKVHLYGSYYVSRAAATHFKEQASGALVHMTSTSGLIGNLGQANYSAAKLGIVAL
SKSIALDMQKFNVRSNCIAPFAWSRMIGAIPTDTDEQRARVDKIKQMTPAKVAPLAVYLA
SDAAAAVNGQIFSVRNNEISLISQPRPVRSIHRSEGWTPQSIAEHAMPAMRASFFPLDRS
ADVFSWDPV