Protein Info for GFF60 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: HtrA protease/chaperone protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02037: peptidase Do" amino acids 41 to 473 (433 residues), 552.5 bits, see alignment E=3.5e-170 PF00089: Trypsin" amino acids 107 to 276 (170 residues), 86.6 bits, see alignment E=5.7e-28 PF13365: Trypsin_2" amino acids 115 to 251 (137 residues), 115.5 bits, see alignment E=8.9e-37 PF00595: PDZ" amino acids 288 to 368 (81 residues), 57.5 bits, see alignment E=3.6e-19 amino acids 392 to 464 (73 residues), 52.4 bits, see alignment E=1.4e-17 PF13180: PDZ_2" amino acids 304 to 381 (78 residues), 52.3 bits, see alignment E=1.4e-17 amino acids 406 to 454 (49 residues), 36.2 bits, see alignment 1.5e-12 PF17820: PDZ_6" amino acids 316 to 352 (37 residues), 40.6 bits, see alignment 4.2e-14 amino acids 413 to 465 (53 residues), 41.3 bits, see alignment 2.5e-14

Best Hits

Swiss-Prot: 100% identical to DEGP_SALTY: Periplasmic serine endoprotease DegP (degP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04771, serine protease Do [EC: 3.4.21.107] (inferred from 100% identity to sty:STY0231)

MetaCyc: 92% identical to periplasmic serine endoprotease DegP (Escherichia coli K-12 substr. MG1655)
Peptidase Do. [EC: 3.4.21.107]

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>GFF60 HtrA protease/chaperone protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKTTLAMSALALSLGLALSPLSATAAETSSSAMTAQQMPSLAPMLEKVMPSVVSINVEG
STTVNTPRMPRNFQQFFGDDSPFCQDGSPFQNSPFCQGGGNGGNGGQQQKFMALGSGVII
DAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDIALIQIQNPKNLTAIKLA
DSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNVENYENFIQTDAAINRGNSGGA
LVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELN
SELAKAMKVDAQRGAFVSQVMPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPV
GSKISLGLLREGKAITVNLELQQSSQSQVDSSTIFSGIEGAEMSNKGQDKGVVVSSVKAN
SPAAQIGLKKGDVIIGANQQPVKNIAELRKILDSKPSVLALNIQRGDSSIYLLMQ