Protein Info for GFF6 in Xanthobacter sp. DMC5

Annotation: 50S ribosomal protein L10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 17 to 34 (18 residues), see Phobius details PF00466: Ribosomal_L10" amino acids 3 to 98 (96 residues), 94.1 bits, see alignment E=2.5e-31

Best Hits

Swiss-Prot: 95% identical to RL10_AZOC5: 50S ribosomal protein L10 (rplJ) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K02864, large subunit ribosomal protein L10 (inferred from 95% identity to azc:AZC_0885)

Predicted SEED Role

"LSU ribosomal protein L10p (P0)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>GFF6 50S ribosomal protein L10 (Xanthobacter sp. DMC5)
VDRAEKQELVTTLTEVFKTTSVVVVAHYSGLTVAQMSKLRRQMKAEGATVKVAKNRLAKI
ALEGSDVAHVASLLKGPTVIAYSSDPVAAPKVAVEFAKANDKFVILGGAMGKTALNVDGV
KALATLPSLDELRAKLVGLIQAPATKIAQLTTAPAAKLARVFGAYAKQDEAA