Protein Info for GFF5938 in Variovorax sp. SCN45

Annotation: T6SS component TssF (ImpG/VasA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 PF05947: T6SS_TssF" amino acids 1 to 627 (627 residues), 699.7 bits, see alignment E=1.8e-214 TIGR03359: type VI secretion protein, TIGR03359 family" amino acids 6 to 629 (624 residues), 586.1 bits, see alignment E=5.3e-180

Best Hits

KEGG orthology group: K11896, type VI secretion system protein ImpG (inferred from 91% identity to vap:Vapar_0527)

Predicted SEED Role

"Protein ImpG/VasA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>GFF5938 T6SS component TssF (ImpG/VasA) (Variovorax sp. SCN45)
MDPRLLSLYEQELRYFRESASEFARAFPKIAHRLGIEGQEVADPYVERLIEATAFLSARV
GLKLDAEYPRFTGHLLDIVYPHFLAPTPAMVVVCIAPDPDDANLAAGPTLPRGSGLRARQ
AVGQNTHCEFRTASALRVWPVEVQRAQYFTYAPDLPLNTHPQSRAIRGGLRIGLRATAGL
NFSQIALDDLVLHFGGAEDVAWQLHECALGQPVGVLVRPLSPSGALHGAAQSLPASAIGA
VGFEEDEALLPATATGFSGFRLLQEYFAFPQRFQFARIGGLKSVLAAMPVADVEIVLLFS
RGDAALEKLVSADNVQLHCVPAVNLFTKRLDRVPMTEGVSQFHLVPDRTRPQDFEVHTVT
EVIGHGTPGTDAAAAEQPFRPFYSAFHGSRLSHPAYFTTTREPRMLSVRQRTEGNRSSHI
GSEVYMQIVDPQQAPYAASLRQLAVTALCTNRDLPLLMPLGRDNDFDCVDSFPVQRVRMV
RGPSRPVSPVVSQGLGWRVVDHLALNYLSLSDSTPEQGAAALRETLMLYAVHADEMRQGQ
VRGLLSVKSKPVARRLPMKGPIAFGRGLEVTLEVDKDAFHGHSAFLFGAVLARFLARHVE
VNHFVETVLRIAGRGETMRWRPLCGTRQIL