Protein Info for GFF5936 in Variovorax sp. SCN45

Annotation: T6SS AAA+ chaperone ClpV (TssH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 909 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 898 (886 residues), 1277.4 bits, see alignment E=0 PF13191: AAA_16" amino acids 212 to 267 (56 residues), 34.7 bits, see alignment 1.5e-11 PF00004: AAA" amino acids 235 to 366 (132 residues), 43.6 bits, see alignment E=2.3e-14 amino acids 647 to 731 (85 residues), 27.2 bits, see alignment E=2.7e-09 PF17871: AAA_lid_9" amino acids 375 to 466 (92 residues), 106 bits, see alignment E=5.1e-34 PF07724: AAA_2" amino acids 641 to 807 (167 residues), 179.9 bits, see alignment E=2.3e-56 PF07728: AAA_5" amino acids 646 to 764 (119 residues), 32.4 bits, see alignment E=4.9e-11 PF10431: ClpB_D2-small" amino acids 814 to 890 (77 residues), 49.6 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 72% identity to azo:azo3903)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (909 amino acids)

>GFF5936 T6SS AAA+ chaperone ClpV (TssH) (Variovorax sp. SCN45)
MSEISRTALFGKLNSLAYKAIEGATVFCKMRGNPYVELEHWFAQLLQAQDSDLHRVIQHY
GLDVSVIAKDMTAALDRLPRGATAISDFSPHIENAIERAWTYATLQFGEAQVRTGYILVG
MLKTQSLRNPLFGLSKQFEKVKVEDLADNFAKICDASPEAQMRAQDGTGMGSGAPGEDAG
AMAPAAMGKGDALKKFAVDLTEKAKKGEMDPVTGRDEEIRQIVDILMRRRQNNPLLTGEA
GVGKTAVVEGFAQRLARGDVPPQLKDVKLLTLDIGLLQAGASMKGEFEQRLRQVIDEVQS
SPTPIILFIDEIHTLVGAGGAAGTGDAANLLKPALARGNLRTIGATTWAEYKKYIEKDPA
LTRRFQVVQVPEPDEQKAILMLRGVASVLEKHHRVQLLDEAIEAAVKLSHRYIPARQLPD
KAVSLLDTACARVAVSQHATPPEVEDCMRRIEGLTVEQEIIGREEAIGIDVTKRAAQVAA
LLAESKVQLDALNARWQEEKGLVDRLLELRAKLRAGNKPVDSVKADGDAKADVPPPQPSP
SGGGSEDRAALLAELHELQAKIHAVQGESPLILPSVDEQAVASVVADWTGIPVGRMVKNE
VEAVLKLADTLNQRVIGQKHGLEMIARRIQTSRARLDNPQKPIGVFMLCGTSGVGKTETA
LALAEALYGGEQNIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGILTEAVRRRPYSVVL
LDEVEKAHPDVHEIFFQVFDKGWMEDGEGRMIDFKNTIILLTTNAGSELVMSMCRDPELL
PDSNALADALKAPLMKVFPPALLGRIVTIPYYPLSPDMMKKIVRLQLGRIKKRVEANHGV
PFDYSDAVVDQVVARCQDPESGGRVIDAILTNTVLPTISVEYLQRLASGGEIRRVALDVK
DADFTYAFD